Index 
Search
Download
Help
ASC_00232: BRG1 protein
ID:

ASC_00232
AC:

232
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

BRG1 protein
GN:

BRG1
OS:

Homo sapiens (Human)
P1:

9128241 (1997)
P2:

9128241 (1997)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SP:

Q90753
SS:

SWISSPROT/TrEMBL
SI:

1630 AA; 183213 Da; calculated pI: 7.62
SQ:

MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSEHSMMGPSPGPPTAGHPLPPQG
PGAYAQDNMHQMHKPMDSMHEKGMAEDPRYGQMKGMGMRPGAHAGMGPPPSPMDQHSQGY
PSPLGGSEHASSPVPANGPSSGPQLPSGPSGVPMDGADPQALGQQNRGPTPFNQNQLHQL
RAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSGTGAVQGPVQGPGP
GPTPPNYNRPHGIGGANMPPPGPSGVPPGMSGQPPGGPPKPWPEGPMANAAAPTSAPQKL
IPPQTTGRPSPAPPAVPPAVSPVCPPQTQSPGQPAQPAPMVQLHQKQNRITPIQKPRGLD
PVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVV
CMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQH
AKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLI
DQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTAAIGPD
GEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGS
EEEEEEEEEEQPQPAQPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQA
LARGLQSYYAVAHAVTERVDKQSTLMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGL
GKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRA
FVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVA
PRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETIL
IIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSE
KDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFE
LLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFN
EPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLR
LCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRCGA
ASSLCLTAEPEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKP
RLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEG
TLEEIEEEVRQKKSSRKRKRDAEGPPAPPVSTRSREKDEDSKKQKKRGRPPAEKLSPNPP
NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRN
HKYRSLNDLEKDVMLLCQNAQTFNLEVSLIYEDSIVLQSVFTSVRQKIEKEEESEGEDSE
EEEEGEEEGSESEARSVKVKIKLGRKEKAQERLKGRRRASRGSRAKPVVSDDDSDEEQEE
ERSGSGTEED

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab