Index 
Search
Download
Help
ASC_00229: Hairless protein
ID:

ASC_00229
AC:

229
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Hairless protein
GN:

HR
OS:

Mus musculus (Mouse)
P1:

11148138 (2001)
P2:

11148138 (2001)
SP:

HAIR_MOUSE, Q61645
SS:

SWISSPROT/TrEMBL
SI:

1182 AA; 127039 Da; calculated pI: 7.13
SQ:

MESMPSFLKDTPAWEKTAPVNGIVGQEPGTSPQDGLRHGALCLGEPAPFWRGVLSTPDSW
LPPGFLQGPKDTLSLVEGEGPRNGERKGSWLGGKEGLRWKEAMLAHPLAFCGPACPPRYG
PLIPEHSGGHPKSDPVAFRPLHCPFLLETKILERAPFWVPTCLPPYLMSSLPPERPYDWP
LAPNPWVYSGSQPKVPSAFGLGSKGFYHKDPNILRPAKEPLAESGMLGLAPGGHLQQACE
SEGPSLHQRDGETGAGRQQNLCPVFLGYPDTVPRAPWPSCPPGLVHSLGNIWAGPGSNSL
GYQLGPPATPRCPSPGPPTPPGGCCSSHLPAREGDLGPCRKCQDSPEGGSSGPGESSEER
NKADSRACPPSHHTKLKKTWLTRHSEQFECPGGCSGKEESSATGLRALKRAGSPEVQGAS
RGPAPKRPSHPFPGTGRQGARAWQETPETIIGSKAEAEQQEEQRGPRDGRIRLQESRLVD
TSCQHHLAGVTQCQSCVQAAGEVGVLTGHSQKSRRSPLEEKQLEEEDSSATSEEGGGGPG
PEASLNKGLAKHLLSGLGDRLCRLLRKEREALAWAQREGQGPAMTEDSPGIPHCCSRCHH
GLFNTHWRCSHCSHRLCVACGRIAGAGKNREKTGSQEQHTDDCAQEAGHAACSLILTQFV
SSQALAELSTVMHQVWAKFDIRGHCFCQVDARVWAPGDGGQQKEPTEKTPPTPQPSCNGD
SNRTKDIKEETPDSTESPAEDGAGRSPLPCPSLCELLASTAVKLCLGHDRIHMAFAPVTP
ALPSDDRITNILDSIIAQVVERKIQEKALGPGLRAGSGLRKGLSLPLSPVRTRLSPPGAL
LWLQEPRPKHGFHLFQEHWRQGQPVLVSGIQKTLRLSLWGMEALGTLGGQVQTLTALGPP
QPTNLDSTAFWEGFSHPETRPKLDEGSVLLLHRTLGDKDASRVQNLASSLPLPEYCAHQG
KLNLASYLPLGLTLHPLEPQLWAAYGVNSHRGHLGTKNLCVEVSDLISILVHAEAQLPPW
YRAQKDFLSGLDGEGLWSPGSQTSTVWHVFRAQDAQRIRRFLQMVCPAGAGTLEPGAPGS
CYLDAGLRRRLREEWGVSCWTLLQAPGEAVLVPAGAPHQVQGLVSTISVTQHFLSPETSA
LSAQLYHQGASLPPDHRMLYAQMDRAVFQAVKAAVGALQEAK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab