Index 
Search
Download
Help
ASC_00226: Myc transforming protein
ID:

ASC_00226
AC:

226
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Myc transforming protein
GN:

V-MYC
OS:

avian myelocytomatosis virus CMII
P1:

3872410 (1985)
P2:

3872410 (1985)
SP:

MYC_AVIM2, P10395
SS:

SWISSPROT/TrEMBL
SI:

421 AA; 46402 Da; calculated pI: 5.24
SQ:

AAAAAMPLSASLPSKNYDYDYDSVQPYFYFEEEEENFYLAAQQRGSELQPPAPSEDIWKK
FELLPTPPLSPSRRSSLAAASCFPSTADQLEMVTELLGGDMVNQSFICDPDDESFVKSII
IQDCMWSGFSAAAKLEKVVSEKLATYQASRREGGPAAASRPGPPPSGPPPPPAGPAASAG
LYLHDLGAAAADCIDPSVVFPYPLSERAPRAAPPGANPAALLGVDTPPTTSSDSEEEQEE
DEEIDVVTLAEANESESSTESSTEASEEHCKPHHSPLVLKRCHVNIHQHNYAAPPSTKVE
YPAAKRLKLDSGRVLKQISNNRKCSSPRTSDSEENDKRRTHNVLERQRRNELKLSFFALR
DQIPEVANNEKAPKVVILKKATEYVLSIQSDEHRLIAEKEQLRRRREQLKHKLEQLRNSR
E

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab