Index 
Search
Download
Help
ASC_00225: Transforming protein Myb
ID:

ASC_00225
AC:

225
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Transforming protein Myb
GN:

V-MYB
OS:

avian myeloblastosis virus
CT:

haematopoietic cell
P1:

10954158 (2000), 3018495 (1985)
P2:

10954158 (2000), 3018495 (1985), 3023837 (1986)
SP:

MYB_AVIMB, P01104
PD:

1H8A
SS:

SWISSPROT/TrEMBL
SI:

382 AA; 43013 Da; calculated pI: 7.17
SQ:

NRTDVQCQHRWQKVLNPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKGRIGKQCR
ERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRR
KVEQEGYPQESSKAGPPSATTGFQKSSHLMAFAHNPPAGPLPGAGQAPLGSDYPYYHIAE
PQNVPGQIPYPVALHINIINVPQPAAAAIQRHYTDEDPEKEKRIKELELLLMSTENELKG
QQALPTQNHTANYPGWHSTTVADNTRTSGDNAPVSCLGEHHHCTPSPPVDHGCLPEESAS
PARCMIVHQSNILDNVKNLLEFAETLQLIDSFLNTSSNHENLNLDNPALTSTPVCGHKMS
VTTPFHKDQTFTEYRKMHGGAV

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab