Index 
Search
Download
Help
ASC_00224: Zinc-finger protein RFP
ID:

ASC_00224
AC:

224
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Zinc-finger protein RFP
Ret finger protein
Tripartite motif protein 27
GN:

RFP
TRIM27
OS:

Rattus norvegicus (Rat)
P1:

1437549 (1992)
P2:

1437549 (1992)
CC:

sequence taken from mouse
SP:

RFP_MOUSE, Q62158
SS:

SWISSPROT/TrEMBL
SI:

522 AA; 59482 Da; calculated pI: 6.05
SQ:

MPAAQPARAMASGSVAECLQQETTCPVCLQYFVEPMMLDCGHNICCACLARCWGAAETNV
SCPQCRETFPQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEQDQ
MPICVVCDRSREHRDHSVLPLEEAVEGFKEQIQNRLDHLRRVKDLKKRRRAQGEQARAEL
LSLTQMEREKIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSG
LIAQLEEKQQQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESL
KQFTEKMQSDMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNP
ERFNLFPCVLGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSL
WYGKEYWALTSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVR
PYFSLSYSGGKSARPLIICPMSGIDGFSGHVGNHGHSMETSP

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab