Index 
Search
Download
Help
ASC_00223: Zinc-finger protein RFP
ID:

ASC_00223
AC:

223
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Zinc-finger protein RFP
Ret finger protein
Tripartite motif protein 27
GN:

RFP
TRIM27
OS:

Homo sapiens (Human)
P1:

1437549 (1992)
P2:

1437549 (1992)
SP:

RFP_HUMAN, P14373
SS:

SWISSPROT/TrEMBL
SI:

513 AA; 58423 Da; calculated pI: 5.83
SQ:

MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETF
PQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDR
SREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV
LGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL
TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG
GKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab