Index 
Search
Download
Help
ASC_00222: Bcl-2-related protein A1
ID:

ASC_00222
AC:

222
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Bcl-2-related protein A1
BFL-1 protein
Hemopoietic-specific early response protein
A1-A
GN:

BCL2A1
BCL2A1A
BFL1
A1
OS:

Mus musculus (Mouse)
CT:

cos-7
P1:

11526431 (2001)
P2:

11526431 (2001)
SP:

BFL1_MOUSE, Q07440
SS:

SWISSPROT/TrEMBL
SI:

172 AA; 19891 Da; calculated pI: 5.24
SQ:

MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFH
VESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSS
FVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab