Index 
Search
Download
Help
ASC_00220: Nuclear matrix protein NMP200
ID:

ASC_00220
AC:

220
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Nuclear matrix protein NMP200
OS:

Homo sapiens (Human)
CT:

various
P1:

11082287 (2000)
P2:

11082287 (2000), 12032676 (2002)
SP:

Q9UMS4
SS:

SWISSPROT/TrEMBL
SI:

504 AA; 55118 Da; calculated pI: 6.14
SQ:

MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP
IRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARL
TKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKA
TVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTG
GADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQ
VVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHP
DGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWD
LRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTG
VAFGHHAKFIASTGMDRSLKFYSL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab