Index 
Search
Download
Help
ASC_00213: E7 protein
ID:

ASC_00213
AC:

213
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

E7 protein
GN:

E7
OS:

human papillomavirus type 16
CT:

yeast
P1:

1547958 (1992)
P2:

1547958 (1992)
SP:

VE7_HPV16, P03129
SS:

SWISSPROT/TrEMBL
SI:

98 AA; 11010 Da; calculated pI: 4.20
SQ:

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCK
CDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab