Index 
Search
Download
Help
ASC_00212: BRM Protein
ID:

ASC_00212
AC:

212
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

BRM Protein
GN:

BRM
OS:

Homo sapiens (Human)
CT:

nb4 cell
P1:

11259672 (2001)
P2:

11259672 (2001), 9128241 (1997)
CC:

20kDa carboxyterminal region (containing bromodomain) targets BRM to NM
SP:

Q90755
SS:

SWISSPROT/TrEMBL
SI:

1568 AA; 178076 Da; calculated pI: 6.71
SQ:

MSTPTDPGAMPHPGPSPGPGPSPGPILGPSPGPGPSPGSVHSMMGPSPGPPSVPHQMPAM
GATDYPQEGMHQMHKSIDGLHEKGMVEDVHCGSMKTMRPPHPGMGPPQSPMDQHSQGYMS
PHPSPLGAPEHVSSPMSGGGPTPPQMTPSQPGPIIPGDPQVMNQPNRGPSPFSPVQLHQL
RAQILAYKMLARGQPLPENLQLAVQGKRTLPGIQQQEPPSAFNRQSGIGMHPMSGAATGP
GPAAGIPGHTAAITSKTWNEGQTPDMSVSSAPQKLPAPSPSGRPSPAPTAAQPAAAMPGP
SVPQPPPGQPSPIVQLQQKQNRISPIQKPQGLDPVEILQEREYRLQARIAHRIQELENLP
GSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKRQTLRE
ARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHA
NTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLVW
EHKQAQAAKEKKKRRRRKKKAEENAEGMASGLGPDGEPIDESSQMSDLPVKVTHTETGKV
LLGPEAPKASQLDAWLEMNPGYEVAPRSDSEDESGSEYEEEDDEEESSRLEADEKILLDP
NSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSYYTVAHAITERVEKQSSLLINGTL
KHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLST
LSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIR
WKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFK
SCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEY
VIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQH
IEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMED
YFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVIIF
DSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMF
DQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDRRRED
ARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQ
WLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDSGKEDGEKAKKRRGRPPAEKLSPNPPKLT
KQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYR
SLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESEDESNDDEDE
DDEEESESESKSVKVKIKLNKKDEKSREKGKGKKRQSRAKAKPVVSDDDSDEDQDENDQS
EASGSDDE

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab