Index 
Search
Download
Help
ASC_00210: Machado-Joseph disease protein 1
ID:

ASC_00210
AC:

210
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Machado-Joseph disease protein 1
Ataxin-3
Spinocerebellar ataxia type 3 protein
GN:

MJD
MJD1
SCA3
ATX3
CT:

neuroblastoma cell
P1:

10556285 (1999), 9580663 (1998)
P2:

10556285 (1999), 9580663 (1998)
CC:

take the last 100 residues (C-terminal) as NM-interaction domain
SP:

MJD1_HUMAN, P54252
SS:

SWISSPROT/TrEMBL
SI:

360 AA; 41485 Da; calculated pI: 4.81
SQ:

MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRT
FLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHW
FTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQM
IRVQQMHRPKLIGEELAQLKEQRVHKTDLERMLEANDGSGMLDEDEEDLQRALALSRQEI
DMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFEKQQQKQQQQQ
QQQQQQQQQQQQQQQQQRDLSGQSSHPCERPATSSGALGSDLGKACSPFIMFATFTLYLT

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab