Index 
Search
Download
Help
ASC_00208: MAR binding filament-like protein 1
ID:

ASC_00208
AC:

208
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

MAR binding filament-like protein 1
GN:

MFP1
OS:

tomato
P1:

8953774 (1996), 10368182 (1999), 10488241 (1999)
P2:

8953774 (1996), 10368182 (1999), 10488241 (1999)
SP:

MFP1_LYCES, P93203
SS:

SWISSPROT/TrEMBL
SI:

697 AA; 79427 Da; calculated pI: 5.06
SQ:

MATSCFPPFSASSSSLCSSQFTPLLSCPRNTQICRKKRPVMASMHSENQKESNVCNRRSI
LFVGFSVLPLLNLRARALEGLSTDSQAQPQKEETEQTIQGSAGNPFVSLLNGLGVVGSGV
LGSLYALARNEKAVSDATIESMKNKLKDKEDAFVSMKKQFESELLSEREDRNKLIRREGE
ERQALVNQLKSAKTTVISLGQELQNEKKLAEDLKFEIKGLQNDLMNTKEDKKKLQEELKE
KLDLIQVLEEKITLLTTEIKDKEVSLRSNTSKLAEKESEVNSLSDMYQQSQDQLMNLTSE
IKELKDEIQKRERELELKCVSEDNLNVQLNSLLLERDESKKELHAIQKEYSEFKSNSDEK
VASDATLGEQEKRLHQLEEQLGTALSEASKNEVLIADLTREKENLRRMVDAELDNVNKLK
QEIEVTQESLENSRSEVSDITVQLEQLRDLSSKLEREVSKLQMELEETRASLQRNIDETK
HSSELLAAELTTTKELLKKTNEEMHTMSDELVAVSENRDSLQTELVNVYKKREHTRNELK
QEKTIVRTLEEELKFLESQITREKELRKSLEDELEKATESLDEINRNVLALAEELELATS
RNSSLEDEREVHRQSVSEQKQISQEAQENLEDAHSLVMKLGKERESLEKRAKKLEDEMAA
AKGEILRLRSQINSVKAPVEDEEKVVAGEKEKVNVQQ

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab