Index 
Search
Download
Help
ASC_00206: Core-binding factor, beta subunit
ID:

ASC_00206
AC:

206
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Core-binding factor, beta subunit
CBF-beta
Polyomavirus enhancer binding protein 2 beta subunit
PEBP2-beta
PEA2-beta
SL3-3 enhancer factor 1 beta subunit
SL3/AKV core-binding factor beta subunit
GN:

CBFB
OS:

Homo sapiens (Human)
P1:

9566865 (1998)
P2:

9566865 (1998)
SP:

PEBB_HUMAN, Q13951
PD:

1CL3, 1E50, 1H9D
SS:

SWISSPROT/TrEMBL
SI:

182 AA; 21484 Da; calculated pI: 6.23
SQ:

MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVAT
GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLD
GMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTT
RP

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab