Index 
Search
Download
Help
ASC_00201: Polyhedrin
ID:

ASC_00201
AC:

201
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Polyhedrin
Major occlusion protein
GN:

PH
P29
POLH
OS:

nuclear polyhedrosis virus
P1:

1469357 (1992)
P2:

1469357 (1992)
SP:

PYHD_NPVBM, P03237
SS:

SWISSPROT/TrEMBL
SI:

244 AA; 28665 Da; calculated pI: 6.04
SQ:

PNYSYNPTIGRTYVYDNKYYKNLGGLIKNAKRKKHLIEHEKEEKQWDLLDNYMVAEDPFL
GPGKNQKLTLFKEVRNVKPDTMKLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVYLV
ANLKPTRPNRCYKFLAQHALRWDEDYVPHEVIRIMEPSYVGMNNEYRISLAKKGGGCPIM
NIHSEYTNSFESFVNRVIWENFYKPIVYIGTDSAEEEEILIEVSLVFKIKEFAPDAPLFT
GPAY

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab