Index 
Search
Download
Help
ASC_00200: MTG8 protein
ID:

ASC_00200
AC:

200
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

MTG8 protein
ETO protein
Eigth twenty one protein
Cyclin D related protein
Zinc finger MYND domain containing protein 2
GN:

CBFA2T1
MTG8
ETO
CDR
ZMYND2
OS:

Homo sapiens (Human)
P1:

12559562 (2003)
P2:

12559562 (2003)
CC:

ETO
SP:

MTG8_HUMAN, Q06455
SS:

SWISSPROT/TrEMBL
SI:

604 AA; 67491 Da; calculated pI: 8.15
SQ:

MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPP
TTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGA
RQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPF
VIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENG
KRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHY
RLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHL
LNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVN
PDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMIT
TERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQ
HKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIE
TTPR

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab