Index 
Search
Download
Help
ASC_00197: Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit
ID:

ASC_00197
AC:

197
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Serine/threonine protein phosphatase PP1-alpha 1 catalytic subunit
PP-1A
GN:

PPP1CA
PPP1A
OS:

mammalian
P1:

9606212 (1998)
P2:

9606212 (1998)
CC:

sequence the same for human, rat, mouse, rabbit
SP:

PP1A_HUMAN, P08129
PD:

1FJM
SS:

SWISSPROT/TrEMBL
SI:

330 AA; 37469 Da; calculated pI: 5.94
SQ:

MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab