Index 
Search
Download
Help
ASC_00196: LOS1 protein
ID:

ASC_00196
AC:

196
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

LOS1 protein
GN:

LOS1
YKL205W
OS:

Saccharomyces cerevisiae (Baker's yeast)
P1:

8366091 (1943)
P2:

8366091 (1943)
SP:

LOS1_YEAST, P33418
SS:

SWISSPROT/TrEMBL
SI:

1100 AA; 126673 Da; calculated pI: 5.01
SQ:

MLERIQQLVNAVNDPRSDVATKRQAIELLNGIKSSENALEIFISLVINENSNDLLKFYGL
STLIELMTEGVNANPNGLNLVKFEITKWLKFQVLGNKQTKLPDFLMNKISEVLTTLFMLM
YSDCNGNQWNSFFDDLMSLFQVDSAISNTSPSTDGNILLGLEFFNKLCLMINSEIADQSF
IRSKESQLKNNNIKDWMRDNDIMKLSNVWFQCLKLDEQIVSQCPGLINSTLDCIGSFISW
IDINLIIDANNYYLQLIYKFLNLKETKISCYNCILAIISKKMKPMDKLAFLNMINLTNEL
TYYHQAISMNPQIITFDNLEVWESLTKLITSFGIEFTIIIEQVNDDQKLDTLYKQSVISN
VDSILLEKIIPILLEFMNNEFDSITAKTFPFWSNYLAFLKKYKASSPNFVPLHKDFLDNF
QQICFKRMKFSDDEVTQDDFEEFNETVRFKLKNFQEIIVVIDPSLFLNNISQEISANLMN
CKNESWQIFELTIYQIFNLSECTKNNYFGLNKNEIMTSQPSLTLVRFLNELLMMKDFLLA
IDNEQIQILFMELIVKNYNFIFSTSANTANATDDDEKYLLILNIFMSSFAMFNKRENVRL
RSWYLFTRFLKLTRINLKKILFANKNLVNEITNKISPLLHIKVTSINAQGTDDNDTIFDN
QLYIFEGIGFIITLNNSSQELTAATANTPIDYDILDQILTPLFTQLEGCITQGASPVVIL
ECHHILMAIGTLARGLHIGLVPENQVNNMVVNKKLINDSLIHKFSNIAEVILVTFSFFNK
FENIRDASRFTFARLIPILSNKILPFINKLIELILSSTDLKSWEMIDFLGFLSQLIHMFH
TDTDCYQLFNQLLTPLINKVHSIIEEIDEQHDQQSSSNKPIDTAVTATSVNKNIVVTDSY
RDKILLKKAYCTFLQSFTNNSVTSILLSDINRAILPVILNDLVTYTPQEIQETSMMKVSL
NVLCNFIKCFGNGTCLDNDDINKDPNLKIDGLNEYFIMKCVPIIFEIPFNPIYKFNIKEG
NFKTMAYDLARLLRELFIVSSNPTTNENECVKYLTQIYLPQIQLPQELTIQLVNMLTTMG
QKQFEKWFVDNFISVLKQGQ

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab