Index 
Search
Download
Help
ASC_00195: Galectin-3
ID:

ASC_00195
AC:

195
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Galectin-3
Galactose-specific lectin 3
MAC-2 antigen
IgE-binding protein
35 kDa lectin
Carbohydrate binding protein 35
CBP 35
Laminin-binding protein
Lectin L-29
L-31
Galactoside-binding protein
GALBP
GN:

LGALS3
MAC2
P1:

8526926 (1995)
P2:

8526926 (1995)
CC:

sequence taken from human
SP:

LEG3_HUMAN, P17931
PD:

1A3K
SS:

SWISSPROT/TrEMBL
SI:

249 AA; 26028 Da; calculated pI: 8.60
SQ:

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPG
AYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLP
LPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNW
GREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDID
LTSASYTMI

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab