Index 
Search
Download
Help
ASC_00177: DNA terminal protein
ID:

ASC_00177
AC:

177
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

DNA terminal protein
Bellett protein
pTP protein
GN:

PTP
OS:

adenovirus
P1:

1870189 (1991)
P2:

1870189 (1991)
CC:

sequence taken from human adenovirus type 2
SP:

TERM_ADE02, P03269
SS:

SWISSPROT/TrEMBL
SI:

653 AA; 74613 Da; calculated pI: 5.93
SQ:

MEHFLPLRNIWNRVRDFPRASTTAAGITWMSRYIYGYHRLMLEDLAPGAPATLRWPLYRQ
PPPHFLVGYQYLVRTCNDYVFDSRAYSRLRYTELSQPGHQTVNWSVMANCTYTINTGAYH
RFVDMDDFQSTLTQVQQAILAERVVADLALLQPMRGFGVTRMGGRGRHLRPNSAAAVAID
ARDAGQEEGEEEVPVERLMQDYYKDLRRCQNEAWGMADRLRIQQAGPKDMVLLSTIRRLK
TAYFNYIISSTSARNNPDRHPLPPATVLSLPCDCDWLDAFLERFSDPVDADSLRSLGGGV
PTQQLLRCIVSAVSLPHGSPPPTHNRDMTGGVFQLRPRENGRAVTETMRRRRGEMIERFV
DRLPVRRRRRRVPPPPPPPEEEEEGEALMEEEIEEEEAPVAFEREVRDTVAELIRLLEEE
LTVSARNSQFFNFAVDFYEAMERLEALGDINESTLRRWVMYFFVAEHTATTLNYLFQRLR
NYAVFARHVELNLAQVVMRARDAEGGVVYSRVWNEGGLNAFSQLMARISNDLAATVERAG
RGDLQEEEIEQFMAEIAYQDNSGDVQEILRQAAVNDTEIDSVELSFRFKLTGPVVFTQRR
QIQEINRRVVAFASNLRAQHQLLPARGADVPLPPLPAGPEPPLPPGARPRHRF

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab