Index 
Search
Download
Help
ASC_00175: FYVE finger-containing phosphoinositide kinase
ID:

ASC_00175
AC:

175
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

FYVE finger-containing phosphoinositide kinase
1-phosphatidylinositol-4-phosphate 5-kinase
PIP5K
PtdIns(4)P-5-kinase
p235
GN:

PIP5K3
PIKFYVE
OS:

Mus musculus (Mouse)
P1:

1312084 (1992)
P2:

1312084 (1992)
SP:

FYV1_MOUSE, Q9Z1T6
SS:

SWISSPROT/TrEMBL
SI:

2052 AA; 232788 Da; calculated pI: 6.34
SQ:

MATDDKSSPTLDSANDLPRSPASPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERG
EGGQGEQQSPSSSWASPQIPSRTQSVRSPVPYKKQLNEELHRRSSVLENTLPHPQESTDS
RRKAEPACGGHDPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSE
KFTTFRRRHHCRLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSI
GEDLNALSDSTCSVSILDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNSALSTRL
VSVQEDAGKSPARNRSASITNLSLDRSGSPMVPSYETSVSPQANRNYIRTETTEDERKIL
LDSAQLKDLWKKICHHTSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAI
GQAMVDGRWLDCVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKD
IKFDDSDTEQIAEEGDDNLAKYLVSDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPL
GWHHNNLELLREENEEKQAMERLLSANHNHMMALLQQLLQNESLSSSWRDIIVSLVCQVV
QTVRPDVKHQDDDMDIRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMNSCIKNPKIL
LLKCSIEYLYREETKFTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLL
EHGITLVINVKSQVLERISRMTQGDLVVSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTL
MFFEGCPQHLGCTIKLRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQ
SPSFHLLTEGRGEEGASQEQVSGSSLPQDPECPREALSSEDSTLLESRTVLEKGELDNKS
IPQAVASLKHQDYTTPTCPAGIPCALFALVPESLLPLHMDQQDAVGNEHRETSQQTDEQQ
DPKSQMKAFRDPLQDDTGMYVTEEVTSSEDQRKTYALTFKQELKDVILCISPVITFREPF
LLTEKGMRCSTRDYFPEQIYWSPLLNKEVKEMESRRKKQLLRDLSGLQGMNGSVQAKSIQ
VLPSHELVSTRIAEHVGDSQTLGRMLADYRARGGEFSQNIWNPFVHSKDDIMYFRWQIRE
TKLRVMKERGLIPSDVIWPTKVDCLNPANHQRLCVLFSSSSAQSSNAPSACVSPWIVTME
FYGKNDLTLGIFLERYCFRYSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPG
YQHTILTYSWCRICKQVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHH
DYHQYFSYNQMVASFSYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYL
AVDERLASLKTDTFSKTREEKMEDIFAQKEMEEGEFKNWTEKMQARLMSSSVDTPQQLQS
IFESLIAKKQSLCEVLQAWNSRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKINAMDTSP
RNISPGLSQWRKRRSLLDNPVQPATSSTHLQLPTPPEALAEQVVGGPTDLDSASGSEDVF
DGHLLGSTDSQVKEKSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKE
PSSIIAFALSCKEYRNALEELSKATLRNSAEEGLPANSALDNRPKSSSPIRLPEISGGQT
NRTVEAEPQPTKKASGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQAGKEGLESQ
GLEPQDEVDGGDTQKKQLTNPHVELQFSDANAKFYCRLYYAGEFHKMREVILGSSEEEFI
RSLSHSSPWQARGGKSGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKR
PTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTG
KESCDVVLLDENLLKMVRDNPLYIRSHSKSELRTSIHSDAHFLSSHLIIDYSLLVGRDDT
SNELVVGIIDYIRTFTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLM
VPDHWTGLDLNC

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab