Index 
Search
Download
Help
ASC_00174: Runt-related transcription factor 1
ID:

ASC_00174
AC:

174
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Runt-related transcription factor 1
Core-binding factor, alpha 2 subunit
CBF-alpha 2
Acute myeloid leukemia 1 protein
Oncogene AML-1
Polyomavirus enhancer binding protein 2 alpha B subunit
PEBP2-alpha B
PEA2-alpha B
SL3-3 enhancer factor 1 alpha B subunit
SL3/AKV core-binding factor alpha B subunit
GN:

RUNX1
CBFA2
AML1
PEBP2AB
OS:

Mus Musculuc (Mouse)
P1:

15034051 (2004)
P2:

11035023 (2001), 10559245 (1999), 15034051 (2004)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SP:

RUN1_MOUSE, Q03347
PD:

1EAN, 1EAO, 1EAQ, 1HJB, 1HJC, 1IO4
SS:

SWISSPROT/TrEMBL
SI:

451 AA; 48609 Da; calculated pI: 9.40
SQ:

MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDGGPALASKLRSGDRSMVEVLADHPG
ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA
TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM
QDARQIQPSPPWSYDQSYQYLGSITSSSVHPATPISPGRASGMTSLSAELSSRLSTAPDL
TAFGDPRQFPTLPSISDPRMHYPGAFTYSPPVTSGIGIGMSAMSSASRYHTYLPPPYPGS
SQAQAGPFQTGSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGAALLNPSLPS
QSDVVETEGSHSNSPTNMPPARLEEAVWRPY

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab