Index 
Search
Download
Help
ASC_00155: Myb proto-oncogene protein
ID:

ASC_00155
AC:

155
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Myb proto-oncogene protein
C-myb
GN:

MYB
OS:

avian
P1:

3333362 (1986)
P2:

3014652 (1986), 3290804 (1988), 3333362 (1986)
CC:

sequence taken from chick
SP:

MYB_CHICK, P01103
PD:

1POM
SS:

SWISSPROT/TrEMBL
SI:

641 AA; 72385 Da; calculated pI: 6.53
SQ:

MARRPRHSIYSSDDDEEDVEMYDHDYDGLLPKAGKRHLGKTRWTREEDEKLKKLVEQNGT
EDWKVIASFLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAK
HLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKAGLPSATTGFQKSSHLMAFAHNPPAGPLPGAGQAPL
GSDYPYYHIAEPQNVPGQIPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
LLMSTENELKGQQALPTQNHTANYPGWHSTTVADNTRTSGDNAPVSCLGEHHHCTPSPPV
DHGCLPEESASPARCMIVHQSNILDNVKNLLEFAETLQLIDSFLNTSSNHENLNLDNPAL
TSTPVCGHKMSVTTPFHRDQPFKTQKENHVFRTPAIKRSILESSPRTPTPFKNALAAQEI
KYGPLKMLPQTPTHLVEDLQDVIKQESEESAIVAGLHESGPPLLKKIKQEVESPTDKAGN
FFCSNHWEGENLNTQLFTHASTMEDVPNLLTSSILKMPVSEEEGSFHKAFAVPRNRPLAS
PMQHLNNAWESASCGKTEDQMALTDQARKYMAAFPTRTLVM

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab