Index 
Search
Download
Help
ASC_00152: Myb proto-oncogene protein
ID:

ASC_00152
AC:

152
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Myb proto-oncogene protein
C-myb
GN:

MYB
OS:

Mus musculus (Mouse)
P1:

3333362 (1986)
P2:

3014652 (1986), 3290804 (1988), 3333362 (1986)
SP:

MYB_MOUSE, P06876
PD:

1H88, 1H89, 1IDY, 1IDZ, 1MBE, 1MBF, 1MBG, 1MBH, 1MBJ, 1MBK, 1MSE, 1MSF
SS:

SWISSPROT/TrEMBL
SI:

636 AA; 71370 Da; calculated pI: 6.52
SQ:

MARRPRHSIYSSDEDDEDIEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGT
DDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAK
HLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQEPSKASQTPVATSFQKNNHLMGFGHASPPSQLSPSGQSSV
NSEYPYYHIAEAQNISSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
LLMSTENELKGQQALPTQNHTCSYPGWHSTSIVDQTRPHGDSAPVSCLGEHHATPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHESSGLDAPTLP
STPLIGHKLTPCRDQTVKTQKENSIFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPL
KMLPQTPSHAVEDLQDVIKRESDESGIVAEFQESGPPLLKKIKQEVESPTEKSGNFFCSN
HWAENSLSTQLFSQASPVADAPNILTSSVLMTPVSEDEDNVLKAFTVPKNRPLVGPLQPC
SGAWEPASCGKTEDQMTASGPARKYVNAFSARTLVM

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab