Index 
Search
Download
Help
ASC_00140: Transcription factor AP-1
ID:

ASC_00140
AC:

140
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Transcription factor AP-1
Activator protein 1
AP1
Proto-oncogene c-jun
V-jun avian sarcoma virus 17 oncogene homolog
p39
GN:

JUN
OS:

Homo sapiens (Human)
CT:

HeLa cell
P1:

8357791 (1993)
P2:

8357791 (1993)
SP:

AP1_HUMAN, P05412
PD:

1A02, 1FOS, 1JNM, 1JUN
SS:

SWISSPROT/TrEMBL
SI:

331 AA; 35635 Da; calculated pI: 8.90
SQ:

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab