Index 
Search
Download
Help
ASC_00139: Retinoblastoma 1
ID:

ASC_00139
AC:

139
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Retinoblastoma 1
GN:

RB1
P1:

8003286 (1993)
P2:

8003286 (1993)
CC:

sequence taken from human
SP:

Q92722
SS:

SWISSPROT/TrEMBL
SI:

92 AA; 11053 Da; calculated pI: 9.59
SQ:

MNRNEQSLQEIWDYVKRPHIHLIGVPESDRENGTKLENTLQDIIQENFPNLARQANIQIQ
ETQRTPHRYSSRRATPRHIIVRFTEVEMKKKF

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab