Index 
Search
Download
Help
ASC_00137: Retinoblastoma-like protein 2
ID:

ASC_00137
AC:

137
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Retinoblastoma-like protein 2
130 kDa retinoblastoma-associated protein
PRB2
P130
RBR-2
PPAR-alpha interacting complex protein 128
PRIC128
GN:

RBL2
OS:

Rattus norvegicus (Rat)
CT:

liver
P1:

9524232 (1998), 8357833 (1993), 1575753 (1992), 8250943 (1993), 10860485 (2000), 11112453 (2000)
P2:

9524232 (1998), 8357833 (1993), 1575753 (1992), 8250943 (1993), 10860485 (2000), 11112453 (2000), 11573202 (2001)
SP:

RBL2_RAT, O55081
SS:

SWISSPROT/TrEMBL
SI:

1135 AA; 127673 Da; calculated pI: 7.88
SQ:

MASGGNQSSPPPPAAAASSEEEEEDGDTADRAQPAGSPSHQIQQRFEELCSRLNMDEAAR
AEAWSSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTAEGNYVSLTRILRCSEQ
SLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEEQPR
QQRGRKQRRQPCTTSEIFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNALQC
SNRKELVNPNFKGVSEDGHPRDSHPSSDPPCVIEKLCSLHDGLVLEAKGIKQHFWKPYIR
KLFEKKLLRGKEENLTGFLEPGNFAESFKAVNKAYEEYVLATGSLDERIFLGEDAEEEVG
TFSRCVSAASGTESAERTQMRDILQQHLDKSKTLRVCNPLTGVRYVQENSPCVTPVSTAT
HSLNRLHTMLAGLRNAPSEKLEQILRSCSRDPTRAIADRLREMYEIYSQHFQPDENVSNC
AKEMANKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGVLEQDAFHKSLLACCLEVVAFS
YKPPGNFPFIAEIFDVPHYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKTKS
PLWDRIRDNENRVPTCEEVTPPHNLERTDEIYIAGSPLTPRRVGEVRTDAGGLGRSVTSP
TTLYDRYSSPTVSTTRRRLFESDSPSEGSTAGRIPPQPLVNAVPVQNVSGETVSVTPVPG
QTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPLSAQA
LAGSLSSQQVTGTTLQVPGPVAIQQISPGGQQQNQGQPLTSSSIRPRKTSSLSLFFRKVY
YLAGVRLRDLCTKLDISDELRKKIWTCFEFSIVQCPELMMDRHLDQLLMCAIYVMAKVTK
EDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRRNSGSCENRSHQNSPTELNTDRASRDSS
PVMRSNSTLPVPQPSSAPPTPTRLTGANSDIEEEERGDLIQFYNNIYRKQIQTFAMKYSQ
ANSQMDTPPLSPYPFVRTGSPRRVQLSQSHPIYISPHKNEAMLSPREKIFYYFSNSPSKR
LREINSMIRTGETPTKKRGILLDDGSESPAKRICPENHSALLRRLQDVANDRGSH

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab