Index 
Search
Download
Help
ASC_00132: RNA-binding protein FUS
ID:

ASC_00132
AC:

132
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

RNA-binding protein FUS
Oncogene FUS
Oncogene TLS
Translocated in liposarcoma protein
POMp75
75 kDa DNA-pairing protein
GN:

FUS
TLS
OS:

Homo sapiens (Human)
P1:

12581738 (2003)
P2:

12581738 (2003)
SP:

FUS_HUMAN, P35637
SS:

SWISSPROT/TrEMBL
SI:

526 AA; 53370 Da; calculated pI: 9.40
SQ:

MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ
SQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSS
SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQD
QSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYE
PRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIES
VADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFS
GNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYD
RGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab