Index 
Search
Download
Help
ASC_00127: Heterogeneous nuclear ribonucleoprotein K
ID:

ASC_00127
AC:

127
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Heterogeneous nuclear ribonucleoprotein K
hnRNP K
DC-stretch binding protein
CSBP
Transformation upregulated nuclear protein
TUNP
GN:

HNRPK
HNRNPK
OS:

Homo sapiens (Human)
CT:

MCF-7 breast cancer cell
P1:

9679963 (1998)
P2:

9679963 (1998)
SP:

ROK_HUMAN, Q07244
PD:

1J5K, 1KHM
SS:

SWISSPROT/TrEMBL
SI:

463 AA; 50919 Da; calculated pI: 5.39
SQ:

METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKL
FQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFT
MMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMA
YEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab