Index 
Search
Download
Help
ASC_00124: Cytokeratin D
ID:

ASC_00124
AC:

124
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Cytokeratin D
P45
endo B type 1 keratin
OS:

Rattus norvegicus (Rat)
CT:

liver
P1:

1280245 (1992)
P2:

1280245 (1992)
CC:

sequence taken from GenBank (CAA68365.1) because sequence in TrEMBL (Q9QWC0) is only a fragment
SP:

Q9QWC0
SS:

GenBank
SI:

132 AA; 14400 Da; calculated pI: 10.06
SQ:

MSFTTRSTTFSTNYRSLGSVRTPSQRVRPASSAASVYAGAGGSGSRISVSRSVWGGSVGS
AGLAGMGGIQTEKETMQDLNDRLASYLDKVKSLETENRRLESKIREHLEKKGPQGVRDWG
HYFKIIEDLRAQ

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab