Index 
Search
Download
Help
ASC_00121: Transcription factor AP-1
ID:

ASC_00121
AC:

121
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Transcription factor AP-1
Activator protein 1
AP1
Proto-oncogene c-jun
V-jun avian sarcoma virus 17 oncogene homolog
GN:

JUN
RJG-9
OS:

Rattus norvegicus (Rat)
CT:

osteosarcoma cell
P1:

8357791 (1993), 8014199 (1994)
P2:

8357791 (1993), 8014199 (1994)
SP:

AP1_RAT, P17325
SS:

SWISSPROT/TrEMBL
SI:

334 AA; 35960 Da; calculated pI: 8.88
SQ:

MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGATGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab