Index 
Search
Download
Help
ASC_00120: Emerin
ID:

ASC_00120
AC:

120
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Emerin
GN:

EMD
STA
EDMD
P1:

9673989 (1998)
P2:

9673989 (1998)
CC:

sequence taken from human
SP:

EMD_HUMAN, P50402
PD:

1JEI
SS:

SWISSPROT/TrEMBL
SI:

254 AA; 28962 Da; calculated pI: 5.29
SQ:

MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYS
FSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQS
VTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLS
YYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLF
FIYHFMQAEEGNPF

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab