Index 
Search
Download
Help
ASC_00106: Acidic leucine-rich nuclear phosphoprotein 32 family member A
ID:

ASC_00106
AC:

106
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Acidic leucine-rich nuclear phosphoprotein 32 family member A
Leucine-rich acidic nuclear protein
GN:

ANP32A
LANP
CT:

purkinje cell
P1:

9353121 (1997)
P2:

9353121 (1997)
CC:

sequence taken from rat
SP:

A32A_RAT, P49911
SS:

SWISSPROT/TrEMBL
SI:

247 AA; 28534 Da; calculated pI: 3.99
SQ:

MEMDKRIYLELRNRTPSDVKELVLDNCRSIEGKIEGLTDEFEELEFLSTINVGLTSISNL
PKLNKLKKLELSENRISGDLEVLAEKCPNLKHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNAYRENVFKLLPQVMYLDGYDRDNKEAPDSDVEGYVEDDDEEDEDEEEYDEY
AQLVEDEEEEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEDAAEEEGSQKRKREPD
DEGQEDD

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab