Index 
Search
Download
Help
ASC_00101: SPARC [Precursor]
ID:

ASC_00101
AC:

101
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

SPARC [Precursor]
Secreted protein acidic and rich in cysteine
Osteonectin
ON
Basement membrane protein BM-40
OS:

Gallus gallus (Chicken)
CT:

embryonic cell
P1:

10404386 (1999)
P2:

10404386 (1999)
SP:

SPRC_CHICK, P36377
SS:

SWISSPROT/TrEMBL
SI:

298 AA; 34022 Da; calculated pI: 4.74
SQ:

MRTWIFFFLCLAGKALAAPQEALADETEVIEDLTTEGPVGANPVQVEVGEFEEPTEDVEE
IVAENPCQNHHCKHGKVCEVDDNNSPMCVCQDPSSCPAHSGVFEKVCGTDNKTYDSSCHF
FATKCTLEGTKKGHKLHLDYIGPCKFIPACLDTELTEFPLRMRDWLKNVLITLYERDEDN
NLLTEKQKLKVKNIHENEKRLEAGDHTVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDG
YLSHTELAPLRAPLIPMEHCTTRFFEACDLDFDKYIALEEWASCFGIKEQDIDKDLVI

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab