Index 
Search
Download
Help
ASC_00100: CpG binding protein
ID:

ASC_00100
AC:

100
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

CpG binding protein
Protein containing PHD finger and CXXC domain 1
GN:

CGBP
PCCX1
OS:

Homo sapiens (Human)
P1:

12200428 (2002)
P2:

12200428 (2002)
SP:

CGBP_HUMAN, Q9P0U4
SS:

SWISSPROT/TrEMBL
SI:

656 AA; 75626 Da; calculated pI: 8.61
SQ:

MEGDGSDPEPPDAGEDSKSENGENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEK
MAKAIREWYCRECREKDPKLEIRYRHKKSRERDGNERDSSEPRDEGGGRKRPVPDPDLQR
RAGSGTGVGAMLARGSASPHKSSPQPLVATPSQHHQQQQQQIKRSARMCGECEACRRTED
CGHCDFCRDMKKFGGPNKIRQKCRLRQCQLRARESYKYFPSSLSPVTPSESLPRPRRPLP
TQQQPQPSQKLGRIREDEGAVASSTVKEPPEATATPEPLSDEDLPLDPDLYQDFCAGAFD
DHGLPWMSDTEESPFLDPALRKRAVKVKHVKRREKKSEKKKEERYKRHRQKQKHKDKWKH
PERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPC
IAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILRAKQQAVREDEESNEGDSDDT
DLQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKT
YCKRLQVLCPEHSRDPKVPADEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLRRAE
VDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPLTTDLRSSADR

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab