Index 
Search
Download
Help
ASC_00098: Thyroid Hormone Receptor beta-1
ID:

ASC_00098
AC:

98
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Thyroid Hormone Receptor beta-1
GN:

THRB
NR1A2
ERBA2
THR1
OS:

Homo sapiens (Human)
CT:

rat pituitary tumor cells (GC cells)
P1:

3005268 (1986)
P2:

3005268 (1986)
CC:

this problem remains to be solved
SP:

THB1_HUMAN, P10828
PD:

1BSX, 1N46, 1NQ0, 1NQ1, 1NQ2, 1NUO, 2NLL
SS:

SWISSPROT/TrEMBL
SI:

461 AA; 52727 Da; calculated pI: 6.68
SQ:

MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab