Index 
Search
Download
Help
ASC_00097: Zinc finger protein PLZF
ID:

ASC_00097
AC:

97
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Zinc finger protein PLZF
Promyelocytic leukemia zinc finger protein
Zinc finger protein 145
GN:

ZNF145
PLZF
OS:

Homo sapiens (Human)
CT:

hematopoietic cell
P1:

11090081 (2000)
P2:

11090081 (2000)
SP:

Z145_HUMAN, Q05516
PD:

1BUO, 1CS3
SS:

SWISSPROT/TrEMBL
SI:

673 AA; 74248 Da; calculated pI: 5.97
SQ:

MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
MLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCDKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab