Index 
Search
Download
Help
ASC_00096: YL-1 protein
ID:

ASC_00096
AC:

96
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

YL-1 protein
Transcription factor-like 1
GN:

TCFL1
YL1
CT:

prostate cancer cell
P1:

9507883 (1998)
P2:

9507883 (1998)
SP:

YL1_HUMAN, Q15906
SS:

SWISSPROT/TrEMBL
SI:

364 AA; 40549 Da; calculated pI: 6.09
SQ:

MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSD
FDIDEGDEPSSDGEAEEPRRKRRVVTKAYKEPLKSLRPRKVNTPAGSSQKAREEKALLPL
ELQDDGSDSRKSMRQSTAEHTRQTFLRVQERQGQSRRRKGPHCERPLTQEELLREAKITE
ELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPKEENVDIEGLDPA
PSVSALTPHAGTGPVNPPARCSRTFITFSDDATFEEWFPQGRPPKVPVREVCPVTHRPAL
YRDPVTDIPYATARAFKIIREAYKKYITAHGLPPTASALGPGPPPPEPLPGSGPRALRQK
IVIK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab