Index 
Search
Download
Help
ASC_00092: Transcription factor HES-1
ID:

ASC_00092
AC:

92
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Transcription factor HES-1
Hairy and enhancer of split 1
Hairy-like
HHL
Hairy homolog
GN:

HES1
HRY
HL
OS:

mammalian
P1:

11035023 (2001)
P2:

11035023 (2001)
CC:

WRPW-motif (at the end of full sequence and NMTS) plays an important role in NM association
SP:

HES1_HUMAN, Q14469
SS:

SWISSPROT/TrEMBL
SI:

280 AA; 29507 Da; calculated pI: 9.66
SQ:

MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP
FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH
SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab