Index 
Search
Download
Help
ASC_00089: CCAAT/enhancer binding protein alpha
ID:

ASC_00089
AC:

89
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

CCAAT/enhancer binding protein alpha
C/EBP alpha
GN:

CEBPA
OS:

Rattus norvegicus (Rat)
CT:

liver
P1:

11023646 (2000)
P2:

11023646 (2000), 11032245 (2000)
SP:

CEBA_RAT, P05554
PD:

1NWQ
SS:

SWISSPROT/TrEMBL
SI:

358 AA; 37329 Da; calculated pI: 7.25
SQ:

MESADFYEAEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSA
GAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQ
PPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPAMGAA
GLPGPGGSLKGLAGPHPDLRTGGGGGGGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR
DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab