Index 
Search
Download
Help
ASC_00083: Wilms' tumor protein homolog
ID:

ASC_00083
AC:

83
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Wilms' tumor protein homolog
GN:

WT1
WT-1
OS:

Mus musculus (Mouse)
CT:

NIH3T cell
P1:

9201704 (1997)
P2:

9201704 (1997)
SP:

WT1_MOUSE, P22561
SS:

SWISSPROT/TrEMBL
SI:

449 AA; 49191 Da; calculated pI: 9.28
SQ:

MGSDVRDLNALLPAVSSLGGGGGGCGLPVSGARQWAPVLDFAPPGASAYGSLGGPAPPPA
PPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTLHFSGQFTGTAGACRYGPFGPPPPSQA
SSGQARMFPNAPYLPSCLESQPTIRNQGYSTVTFDGAPSYGHTPSHHAAQFPNHSFKHED
PMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQ
MNLGATLKGMAAGSSSSVKWTEGQSNHGIGYESENHTAPILCGAQYRIHTHGVFRGIQDV
RRVSGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDC
ERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWHS
CQKKFARSDELVRHHNMHQRNMTKLHVAL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab