Index 
Search
Download
Help
ASC_00080: Wilms' tumor protein
ID:

ASC_00080
AC:

80
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Wilms' tumor protein
WT33
GN:

WT1
OS:

Homo sapiens (Human)
CT:

osteosarcoma HOS, myelogenous leukemia K562 cell
P1:

9201704 (1997)
P2:

9201704 (1997)
SP:

WT1_HUMAN, P19544
PD:

1LU6
SS:

SWISSPROT/TrEMBL
SI:

449 AA; 49133 Da; calculated pI: 9.23
SQ:

MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAP
PPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQA
SSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHED
PMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQ
MNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDV
RRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDC
ERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPS
CQKKFARSDELVRHHNMHQRNMTKLQLAL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab