Index 
Search
Download
Help
ASC_00079: TFIIH basal transcription factor complex helicase XPB subunit
ID:

ASC_00079
AC:

79
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

TFIIH basal transcription factor complex helicase XPB subunit
Basic transcription factor 2 89 kDa subunit
BTF2-p89
TFIIH 89 kDa subunit
DNA-repair protein complementing XP-B cells
Xeroderma pigmentosum group B complementing protein
DNA excision repair protein ERCC-3
GN:

ERCC3
XPB
XPBC
OS:

Cricetulus griseus (Chinese hamster)
P1:

9729238 (1998)
P2:

9729238 (1998)
CC:

sequence taken from mouse
SP:

XPB_MOUSE, P49135
SS:

SWISSPROT/TrEMBL
SI:

783 AA; 89025 Da; calculated pI: 6.79
SQ:

MGKRDRVDRDKKKSKKRQYEEEEEDEDDIPGNESQEAVPSAAGKQVDESSTKVDEYGAKD
YRQQMPLKGDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTA
YSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIIQFIKLCTVSYGKVKLVLKHNRYFVESS
HPDVIQHLLQDPVIRECRLRNAEGEATELITETFTSKSAISKTAAEGSGGPSTSQGVDAQ
ATSDIPKDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCICLEYPLLAEYDFRN
DTLNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRK
RCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKR
SWEAERVMEWLKTQEWGLMILDEVHTIPARMFRRVLTIVQAHCKLGLTATLVREDDKIVD
LNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPN
KFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHN
PKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFF
YSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEELAFSTKEEQQQLLQKVLAA
TDLDAEEEVVAGEFGSRSGQASRRCGTMSSLSGADDTVYMEYHSSRSKASSKHVHPLFKR
FRK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab