Index 
Search
Download
Help
ASC_00076: TFIIH basal transcription factor complex p62 subunit
ID:

ASC_00076
AC:

76
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

TFIIH basal transcription factor complex p62 subunit
Basic transcription factor 62 kDa subunit
BTF2-p62
General transcription factor IIH polypeptide 1
GN:

GTF2H1
OS:

Cricetulus griseus (Chinese hamster)
P1:

9729238 (1998)
P2:

9729238 (1998)
CC:

sequence taken from mouse
SP:

TFH1_MOUSE, Q9DBA9
SS:

SWISSPROT/TrEMBL
SI:

547 AA; 61781 Da; calculated pI: 8.88
SQ:

MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGK
AKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQE
DPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSTSSHKQDVGISAAFLADVRPQTDGC
NGLRYNLTSDIIESIFRTYPAVKMKYAETVPHNMTEKEFWTRFFQSHYFHRDRLNTGSKD
LFAECAKIDEKGLKTMVSLGVKNPMLDLTSLEDKPLDEGYSISSVPSTSNSKSIKENSNA
AIIKRFNHHSAMVLAAGLRKQQAQNGQNGEPSSVDGNSGDTDCFQPAVKRAKLQESIEYE
DLGNNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQV
LSSSAASSTITALSPGGALMQGGTQQAVNQMVPNDIQSELKHLYVAVGELLRHFWSCFPV
NTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQS
RRLMKKT

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab