Index 
Search
Download
Help
ASC_00072: Nuclear Matrix Protein M1
ID:

ASC_00072
AC:

72
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Nuclear Matrix Protein M1
OS:

influenza virus
P1:

11453070 (2001)
P2:

11453070 (2001)
SS:

GenBank
SI:

252 AA; 27820 Da; calculated pI: 9.30
SQ:

MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGIL
GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEVALSYS
AGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV
IASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAY
QKRMGVQMQRFK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab