Index 
Search
Download
Help
ASC_00067: Protein UL31
ID:

ASC_00067
AC:

67
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Protein UL31
GN:

UL31
OS:

hsv-1
P1:

8021242 (1994), 11507225 (2001)
P2:

8021242 (1994), 11507225 (2001)
SP:

UL31_HSV11, P10215
SS:

SWISSPROT/TrEMBL
SI:

306 AA; 33914 Da; calculated pI: 8.97
SQ:

MYDTDPHRRGSRPGPYHGKERRRSRSSAAGGTLGVVRRASRKSLPPHARKQELCLHERQR
YRGLFAALAQTPSEEIAIVRSLSVPLVKTTPVSLPFCLDQTVADNCLTLSGMGYYLGIGG
CCPACNAGDGRFAATSREALILAFVQQINTIFEHRAFLASLVVLADRHNAPLQDLLAGIL
GQPELFFVHTILRGGGACDPRLLFYPDPTYGGHMLYVIFPGTSAHLHYRLIDRMLTACPG
YRFVAHVWQSTFVLVVRRNAEKPTDAEIPTVSAADIYCKMRDISFDGGLMLEYQRLYATF
DEFPPP

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab