Index 
Search
Download
Help
ASC_00064: Major centromere autoantigen B
ID:

ASC_00064
AC:

64
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Major centromere autoantigen B
Centromere protein B
CENP-B
GN:

CENPB
OS:

Homo sapiens (Human)
P1:

9639657 (1998)
P2:

9639657 (1998)
SP:

CENB_HUMAN, P07199
PD:

1BW6, 1HLV
SS:

SWISSPROT/TrEMBL
SI:

599 AA; 65100 Da; calculated pI: 4.49
SQ:

MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYG
VASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASN
GWLDRFRRRHGVVSCSGVARARARNAAPRTPAAPASPAAVPSEGSGGSTTGWRAREEQPP
SVAEGYASQDVFSATETSLWYDFLPDQAAGLCGGDGRPRQATQRLSVLLCANADGSEKLP
PLVAGKSAKPRAGQAGLPCDYTANSKGGVTTQALAKYLKALDTRMAAESRRVLLLAGRLA
AQSLDTSGLRHVQLAFFPPGTVHPLERGVVQQVKGHYRQAMLLKAMAALEGQDPSGLQLG
LTEALHFVAAAWQAVEPSDIAACFREAGFGGGPNATITTSLKSEGEEEEEEEEEEEEEEG
EGEEEEEEGEEEEEEGGEGEELGEEEEVEEEGDVDSDEEEEEDEESSSEGLEAEDWAQGV
VEAGGSFGAYGAQEEAQCPTLHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVP
VPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab