Index 
Search
Download
Help
ASC_00062: Annexin A5
ID:

ASC_00062
AC:

62
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Annexin A5
Annexin V
Lipocortin V
Endonexin II
Calphobindin I
CBP-I
Placental anticoagulant protein I
PAP-I
PP4
Thromboplastin inhibitor
Vascular anticoagulant-alpha
VAC-alpha
Anchorin CII
GN:

ANXA5
ANX5
OS:

Gallus gallus (Chicken)
CT:

liver
P1:

8753782 (1996)
P2:

8753782 (1996)
SP:

ANX5_CHICK, P17153
PD:

1ALA
SS:

SWISSPROT/TrEMBL
SI:

321 AA; 36157 Da; calculated pI: 5.60
SQ:

MAKYTRGTVTAFSPFDARADAEALRKAMKGMGTDEETILKILTSRNNAQRQEIASAFKTL
FGRDLVDDLKSELTGKFETLMVSLMRPARIFDAHALKHAIKGAGTNEKVLTEILASRTPA
EVQNIKQVYMQEYEANLEDKITGETSGHFQRLLVVLLQANRDPDGRVDEALVEKDAQVLF
RAGELKWGTDEETFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGDLEKLLLAV
VKCIRSVPAYFAETLYYSMKGAGTDDDTLIRVMVSRSEIDLLDIRHEFRKNFAKSLYQMI
QKDTSGDYRKALLLLCGGDDE

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab