Index 
Search
Download
Help
ASC_00061: SMARCE1-related protein
ID:

ASC_00061
AC:

61
CL:

ASC
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

SMARCE1-related protein
HMG domain protein HMGX2
High mobility group 20 B
GN:

HMG20B
SMARCE1R
HMGX2
OS:

Homo sapiens (Human)
P1:

11997092 (2002)
P2:

11997092 (2002)
CC:

sequence taken from human
SP:

Q9Z104
SS:

SWISSPROT/TrEMBL
SI:

317 AA; 35829 Da; calculated pI: 9.33
SQ:

MSHGPRQPGAATAPAGGKTPGQHGAFVVAVKQERSEGSRAGEKGPQEEEPVKKRGWPKGK
KRKKILPNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPAEKQRYL
DEAEKEKQQYLKELWAYQQSEAYKVCTEKIQENKIKKEDSSSGLMNTLLNGHKGVDCDGF
STFDVPIFTEEFLDQNKAREAELRRLRKMNVAFEEQNAVLQRHTQSMSSARERLEQELAL
EERRTLALQQQLQAVRQALTASFASLPVPGTGETPTLGTLDFYMARLHGAIERDPAQHER
LIARVKEILARVASEHL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab