Index 
Search
Download
Help
ASC_00058: KRAB zinc finger protein ZFQR
ID:

ASC_00058
AC:

58
CL:

ASC
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

KRAB zinc finger protein ZFQR
OS:

Homo sapiens (Human)
CT:

fibroblast
P1:

11161714 (2001)
P2:

11161714 (2001)
SP:

Q9HAQ4
SS:

SWISSPROT/TrEMBL
SI:

532 AA; 59957 Da; calculated pI: 8.92
SQ:

MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQASKPDALFKL
EQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQF
LLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPA
SQKLISTKSQFISPKHQKTRKLEKHHVCSECGKAFIKKSWLTDHQVMHTGEKPHRCSLCE
KAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIHQKTHTGEKPYICSECGKGFI
QKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSECGKSCSQKSG
LIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKH
KRIHTREKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLA
NRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYILFYVTENP

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab