Enter protein amino acid sequences in FASTA format >tr|B8ZY94|B8ZY94_ECOLX T3SS secreted effector Map
MFSPTAMVGRALAQAVTQTLRPAVTKAATQAGMGANGMRFAAMQSNLMINHGKLTNQLLQ
AVAKQTGSSDTQQWFKQEQITFLSRTVNKTVDDYCMSNNSVINKETKFRIFKAVESAIQQ
PLDMNCAQSSIGHFLQSNKYFNQKVDEQCGKGVDPITRFNTQTKMIELVSREIFEQNFNT
AKVSDIKALTQRAIAENVQDTRL
Due to long running times we recommend not to
submit more than 10000 sequences.
For larger jobs you are welcome to contact us.
OPTIONAL: Email address
HELP Want to be notified once your job is processed?
Your Email address will not be stored or used
for any other purpose

Please cite:
Goldberg T, Rost B, Bromberg Y. Computational prediction shines light on type III secretion origins. Sci Rep. 2016 Oct 7;6:34516.
PubMed PMID: 27713481
Copyright © 2017 BROMBERGLAB all rights reserved.